Comparison

Recombinant Human Ribonuclease P protein subunit p29(POP4)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP018373HU-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFL KRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKK KKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHEL WKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAII SVTKSKCPSYVGITGILLQETKHIFKIITKEDRLK VIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAK KFKAKGTIDL
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O95707
Gene Names
POP4
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-220aa
MW of Fusion Proten
41, 4
Sequence Info
Full Length
Relevance
Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. May function with RPP38 to coordinate the nucleolar targeting and/or assbly of RNase P.
Reference
Rpp14 and Rpp29, two protein subunits of human ribonuclease P.Jarrous N., Eder P.S., Wesolowski D., Altman S.RNA 5:153-157(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 500ug
Available: In stock
Listprice: €880.00
Price: €880.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close