« Back
Home /
Recombinant Human Ribonuclease P protein subunit p29(POP4)

Recombinant Human Ribonuclease P protein subunit p29(POP4)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	E.coli
Item no.	CSB-EP018373HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	O95707
Gene Names	POP4
Organism	Homo sapiens (Human)
AA Sequence	MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFL KRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKK KKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHEL WKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAII SVTKSKCPSYVGITGILLQETKHIFKIITKEDRLK VIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAK KFKAKGTIDL
Expression Region	1-220aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	41.4 kDa
Relevance	Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. May function with RPP38 to coordinate the nucleolar targeting and/or assbly of RNase P.
Reference	Rpp14 and Rpp29, two protein subunits of human ribonuclease P.Jarrous N., Eder P.S., Wesolowski D., Altman S.RNA 5:153-157(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. May function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.
Subcellular Location	Nucleus, nucleolus
Protein Families	Eukaryotic/archaeal RNase P protein component 1 family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP018373HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time