Comparison

Recombinant Human Peroxisome proliferator-activated receptor gamma(PPARG)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 500ug
Host E.coli
Item no. CSB-EP018424HU-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Nuclear receptor subfamily 1 group C member 3
AA Sequence
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTE MPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDF SSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSA IKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECR VCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDR CDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKH LYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDM NSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQF RSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGV HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLR KPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPE SSQLFAKLLQKMTDLRQIVTEH
Research Topic
Transcription
Uniprot ID
P37231
Gene Names
PPARG
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-477aa
MW of Fusion Proten
70, 3
Sequence Info
Full Length of Isoform 1
Relevance
Nuclear receptor that binds peroxisome proliferators such as hypolipidic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elents (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proinflammatory responses. Plays a role in the regulation of cardiovascular circadian rhythms by regulating the transcription of ARNTL/BMAL1 in the blood vessels .
Reference
"Isolation and characterization of a transcriptional cofactor and its novel isoform that bind the DNA-binding domain of peroxisome proliferator-activated receptor gamma."Tomaru T., Satoh T., Yoshino S., Ishizuka T., Hashimoto K., Monden T., Yamada M., Mori M.
Endocrinology 147:377-388(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 500ug
Available: In stock
Listprice: €880.00
Price: €880.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close