Comparison

Recombinant Human Serine/threonine-protein phosphatase PP1-beta catalytic subunit(PPP1CB)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP018504HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRG LCIKSREIFLSQPILLELEAPLKICGDIHGQYTDL LRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLL LAYKIKYPENFFLLRGNHECASINRIYGFYDECKR RFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLS PDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKD VQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRA HQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVT PPRTANPPKKR
Research Topic
Signal Transduction
Uniprot ID
P62140
Gene Names
PPP1CB
Tag Info
N-terminal 6xHis-tagged
Expression Region
2-327aa
MW of Fusion Proten
41, 1
Sequence Info
Full Length of Mature Protein
Relevance
Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208).
Reference
"Characterization of the protein phosphatase 1 catalytic subunit in endothelium: involvement in contractile responses."Verin A.D., Csortos C., Durbin S.D., Aydanyan A., Wang P., Patterson C.E., Garcia J.G.J. Cell. Biochem. 79:113-125(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close