Comparison

Recombinant Pig Prolactin(PRL)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP018724PI-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSE MFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKE QAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGM QEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPG IKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCL RRDSHKIDNYLKLLKCRIIYDSNC
Research Topic
Others
Uniprot ID
P01238
Gene Names
PRL
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
31-229aa
MW of Fusion Proten
39
Sequence Info
Full Length
Relevance
Prolactin acts primarily on the mammary gland by promoting lactation.
Reference
Nucleotide sequence of porcine preprolactin cDNA.Schulz Aellen M.F., Schmid E., Movva R.N.Nucleic Acids Res. 17:3295-3295(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Sus scrofa (Pig)
Amount: 1mg
Available: In stock
Listprice: €1,992.57
Price: €1,992.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close