Comparison

Recombinant Pig Prolactin(PRL)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP018724PI-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P01238
Gene Names
PRL
Organism
Sus scrofa (Pig)
AA Sequence
LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSE MFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKE QAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGM QEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPG IKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCL RRDSHKIDNYLKLLKCRIIYDSNC
Expression Region
31-229aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
39 kDa
Relevance
Prolactin acts primarily on the mammary gland by promoting lactation.
Reference
Nucleotide sequence of porcine preprolactin cDNA.Schulz Aellen M.F., Schmid E., Movva R.N.Nucleic Acids Res. 17:3295-3295(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Prolactin acts primarily on the mammary gland by promoting lactation.
Subcellular Location
Secreted
Protein Families
Somatotropin/prolactin family
Amount: 50ug
Available: In stock
Listprice: €426.10
Price: €426.10
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close