Comparison

Recombinant Rat Major prion protein(Prnp)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP018739RA-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P13852
Gene Names
Prnp
Organism
Rattus norvegicus (Rat)
AA Sequence
GGWNTGGSRYPGQGSPGGNRYPPQSGGTWGQPHGG GWGQPHGGGWGQPHGGGWGQPHGGGWSQGGGTHNQ WNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSA MSRPMLHFGNDWEDRYYRENMYRYPNQVYYRPVDQ YSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDV KMMERVVEQMCVTQYQKESQAYYDGRRS
Expression Region
29-231aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
26.3 kDa
Alternative Name
CD230
Relevance
May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains .
Reference
Three-exon structure of the gene encoding the rat prion protein and its expression in tissues.Saeki K., Matsumoto Y., Hirota Y., Matsumoto Y., Onodera T.Virus Genes 12:15-20(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Its primary physiological function is unclear. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May promote myelin homeostasis through acting as a agonist for ADGRG6 receptor. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro) (By similarity). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu(2+) or ZN(2+) for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains (By similarity).
Involvement in disease
Found in high quantity in the brain of humans and animals infected with degenerative neurological diseases such as kuru, Creutzfeldt-Jakob disease (CJD), Gerstmann-Straussler syndrome (GSS), scrapie, bovine spongiform encephalopathy (BSE), transmissible mink encephalopathy (TME), etc.
Subcellular Location
Cell membrane, Lipid-anchor, GPI-anchor, Golgi apparatus
Protein Families
Prion family
Amount: 50ug
Available: In stock
Listprice: €350.03
Price: €350.03
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close