Comparison

Recombinant Rat Anionic trypsin-1(Prss1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP018811RA-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Anionic trypsin IPretrypsinogen ISerine protease 1
AA Sequence
IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWV VSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKI IKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVAL PSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDA PVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQG DSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVC NFVGWIQDTIAAN
Research Topic
Others
Uniprot ID
P00762
Gene Names
Prss1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
24-246aa
MW of Fusion Proten
39, 6
Sequence Info
Full Length
Reference
Two similar but nonallelic rat pancreatic trypsinogens. Nucleotide sequences of the cloned cDNAs.MacDonald R.J., Stary S.J., Swift G.H.J. Biol. Chem. 257:9724-9732(1982)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Rattus norvegicus (Rat)
Amount: 50ug
Available: In stock
Listprice: €310.35
Price: €310.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close