Comparison

Recombinant Human Serine protease 23(PRSS23)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP018817HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
O95084
Gene Names
PRSS23
Organism
Homo sapiens (Human)
AA Sequence
QVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFG AEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYET LYANGSRTETQVGIYILSSSGDGAQHRDSGSSGKS RRKRQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTG CTGTLVAEKHVLTAAHCIHDGKTYVKGTQKLRVGF LKPKFKDGGRGANDSTSAMPEQMKFQWIRVKRTHV PKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIG VSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKD ETYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWER KIIGIFSGHQWVDMNGSPQDFNVAVRITPLKYAQI CYWIKGNYLDCREG
Expression Region
20-383aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
57 kDa
Alternative Name
Putative secreted protein Zsig13
Reference
A novel serine protease from human umbilical vein endothelial cells.Li X., Tedder T.F. Sheppard P., Blumberg H., Jelinek L., Foster D., O'Hara P.Towards a catalog of human genes and proteins sequencing and analysis of 500 novel complete protein coding human cDNAs.Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.Genome Res. 11:422-435(2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location
Secreted
Protein Families
Peptidase S1 family
Amount: 500ug
Available: In stock
Listprice: €1,013.82
Price: €1,013.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close