Comparison

Recombinant Human PC4 and SFRS1-interacting protein(PSIP1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 1mg
Host E.coli
Item no. CSB-EP018860HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
CLL-associated antigen KW-7Dense fine speckles 70 kDa protein ; DFS 70Lens epithelium-derived growth factorTranscriptional coactivator p75/p52
AA Sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKP PTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGK PNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNAS SDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDIT TPKAARRGRKRKAEKQVETEEAGVVTTATASVNLK VSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDI ITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPR KEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGD DQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRK RKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDS RLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQV TMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANK TKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQP QHNGESNEDSKDNHEASTKKKPSSEERETEISLKD STLDN
Research Topic
Immunology
Uniprot ID
O75475
Gene Names
PSIP1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-530aa
MW of Fusion Proten
76, 1
Sequence Info
Full Length
Relevance
Transcriptional coactivator involved in neuroepithelial st cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration.
Reference
Isolation of cDNAs encoding novel transcription coactivators p52 and p75 reveals an alternate regulatory mechanism of transcriptional activation.Ge H., Si Y., Roeder R.G.EMBO J. 17:6723-6729(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close