Comparison

Recombinant Human PC4 and SFRS1-interacting protein(PSIP1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 500ug
Host E.coli
Item no. CSB-EP018860HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
O75475
Gene Names
PSIP1
Organism
Homo sapiens (Human)
AA Sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKP PTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGK PNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNAS SDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDIT TPKAARRGRKRKAEKQVETEEAGVVTTATASVNLK VSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDI ITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPR KEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGD DQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRK RKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDS RLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQV TMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANK TKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQP QHNGESNEDSKDNHEASTKKKPSSEERETEISLKD STLDN
Expression Region
1-530aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
76.1 kDa
Alternative Name
CLL-associated antigen KW-7Dense fine speckles 70KDA protein . DFS 70Lens epithelium-derived growth factorTranscriptional coactivator p75/p52
Relevance
Transcriptional coactivator involved in neuroepithelial st cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration.
Reference
Isolation of cDNAs encoding novel transcription coactivators p52 and p75 reveals an alternate regulatory mechanism of transcriptional activation.Ge H., Si Y., Roeder R.G.EMBO J. 17:6723-6729(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration.
Involvement in disease
A chromosomal aberration involving PSIP1 is associated with pediatric acute myeloid leukemia (AML) with intermediate characteristics between M2-M3 French-American-British (FAB) subtypes. Translocation t(9; 11)(p22; p15) with NUP98. The chimeric transcript is an in-frame fusion of NUP98 exon 8 to PSIP1 exon 4.
Subcellular Location
Nucleus
Protein Families
HDGF family
Tissue Specificity
Widely expressed. Expressed at high level in the thymus. Expressed in fetal and adult brain. Expressed in neurons, but not astrocytes. Markedly elevated in fetal as compared to adult brain. In the adult brain, expressed in the subventricular zone (SVZ), in hippocampus, and undetectable elsewhere. In the fetal brain, expressed in the germinal neuroepithelium and cortical plate regions.
Amount: 500ug
Available: In stock
Listprice: €1,013.82
Price: €1,013.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close