Recombinant Human Phosphoserine phosphatase(PSPH)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP018938HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P78330
Gene Names
PSPH
Organism
Homo sapiens (Human)
AA Sequence
MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELA KICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQ PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQV FLISGGFRSIVEHVASKLNIPATNVFANRLKFYFN GEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKII MIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAK WYITDFVELLGELEE
Expression Region
1-225aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
52 kDa
Alternative Name(s)
L-3-phosphoserine phosphatase
O-phosphoserine phosphohydrolase
Relevance
Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates
Reference
"Human L-3-phosphoserine phosphatase: sequence, expression and evidence for a phosphoenzyme intermediate."
Collet J.-F., Gerin I., Rider M.H., Veiga-Da-Cunha M., Van Schaftingen E.
FEBS Lett. 408:281-284(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close