Comparison

Recombinant Human Prostaglandin-H2 D-isomerase(PTGDS)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 100ug
Host E.coli
Item no. CSB-EP018969HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Beta-trace protein; Cerebrin-28Glutathione-independent PGD synthaseLipocalin-type prostaglandin-D synthaseProstaglandin-D2 synthase ; PGD2 synthase ; PGDS ; PGDS2
AA Sequence
APEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLRE KKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETR TMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQ YALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEK FTAFCKAQGFTEDTIVFLPQTDKCMTEQ
Research Topic
Metabolism
Uniprot ID
P41222
Gene Names
PTGDS
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
23-190aa
MW of Fusion Proten
34, 7
Sequence Info
Full Length
Relevance
Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NR sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous syst and male reproductive syst.
Reference
Human brain prostaglandin D synthase has been evolutionarily differentiated from lipophilic-ligand carrier proteins.Nagata A., Suzuki Y., Igarashi M., Eguchi N., Toh H., Urade Y., Hayaishi O.Proc. Natl. Acad. Sci. U.S.A. 88:4020-4024(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close