« Back
Home /
Recombinant Human Prostaglandin-H2 D-isomerase(PTGDS)

Recombinant Human Prostaglandin-H2 D-isomerase(PTGDS)

Manufacturer	Cusabio
Category	Oncology Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Enzymes Prostaglandin Synthases By Organ Skin Cancer Testicular & Prostate Cancer Thyroid Cancer
Type	Proteins Recombinant
Specific against	Human
Format	Liquid or Lyophilized powder
Amount	100ug
Host	E.coli
Item no.	CSB-EP018969HU-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Metabolism
Target / Protein	PTGDS
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P41222
AA Sequence	APEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLRE KKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETR TMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQ YALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEK FTAFCKAQGFTEDTIVFLPQTDKCMTEQ
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	23-190aa
Protein Length	Full Length of Mature Protein
MW	34.7 kDa
Distributor Discount	50% off the list price
Alternative Name(s)	Beta-trace protein; Cerebrin-28Glutathione-independent PGD synthaseLipocalin-type prostaglandin-D synthaseProstaglandin-D2 synthase ; PGD2 synthase ; PGDS ; PGDS2
Relevance	Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NR sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous syst and male reproductive syst.
Reference	Human brain prostaglandin D synthase has been evolutionarily differentiated from lipophilic-ligand carrier proteins.Nagata A., Suzuki Y., Igarashi M., Eguchi N., Toh H., Urade Y., Hayaishi O.Proc. Natl. Acad. Sci. U.S.A. 88:4020-4024(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system.
Subcellular Location	Rough endoplasmic reticulum, Nucleus membrane, Golgi apparatus, Cytoplasm, perinuclear region, Secreted
Protein Families	Calycin superfamily, Lipocalin family
Tissue Specificity	Abundant in the brain and CNS, where it is expressed in tissues of the blood-brain barrier and secreted into the cerebro-spinal fluid. Abundantly expressed in the heart. In the male reproductive system, it is expressed in the testis, epididymis and prostate, and is secreted into the seminal fluid. Expressed in the eye and secreted into the aqueous humor. Lower levels detected in various tissue fluids such as serum, normal urine, ascitic fluid and tear fluid. Also found in a number of other organs including ovary, fimbriae of the fallopian tubes, kidney, leukocytes.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP018969HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time