Comparison

Recombinant Human Prostaglandin G/H synthase 2(PTGS2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP018986HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Cyclooxygenase-2 ; COX-2; PHS IIProstaglandin H2 synthase 2 ; PGH synthase 2 ; PGHS-2; Prostaglandin-endoperoxide synthase 2
AA Sequence
ANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGE NCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNV VNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGY KSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQL PDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFT HQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQ RKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYP PQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNR VCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIE DYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEF NTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLE HGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQAS IDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKE MSAELEALYGDIDAVELYPALLVEKPRPDAIFGET MVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGF QIINTASIQSLICNNVKGCPFTSFSVPDPELIKTV TINASSSRSGLDDINPTVLLKERS
Research Topic
Metabolism
Uniprot ID
P35354
Gene Names
PTGS2
Tag Info
N-terminal 6xHis-tagged
Expression Region
18-601aa
MW of Fusion Proten
70, 9
Sequence Info
Partial
Relevance
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and brain, and in pathological conditions, such as in cancer. PTGS2 is responsible for production of inflammatory prostaglandins. Up-regulation of PTGS2 is also associated with increased cell adhesion, phenotypic changes, resistance to apoptosis and tumor angiogenesis. In cancer cells, PTGS2 is a key step in the production of prostaglandin E2 (PGE2), which plays important roles in modulating motility, proliferation and resistance to apoptosis.
Reference
The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close