Comparison

Recombinant Human Parathyroid hormone 2 receptor(PTH2R),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP018990HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
P49190
Gene Names
PTH2R
Organism
Homo sapiens (Human)
AA Sequence
DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEG NCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHK GVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQP DISIGKQEFFERLY
Expression Region
27-145aa
Sequence Info
Extracellular Domain
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
29.6 kDa
Relevance
This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systs. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor .
Reference
Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues.John M.R., Arai M., Rubin D.A., Jonsson K.B., Jueppner H.Endocrinology 143:1047-1057(2002)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor (By similarity).
Subcellular Location
Cell membrane, Multi-pass membrane protein
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Expressed abundantly in brain and pancreas. Also expressed in the testis.
Amount: 500ug
Available: In stock
Listprice: €1,013.82
Price: €1,013.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close