Recombinant Human Receptor-type tyrosine-protein phosphatase C(PTPRC),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP019049HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Immunology
Target / Protein
PTPRC
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
P08575
AA Sequence
QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPA STFERENDFSETTTSLSPDNTSTQVSPDSLDNASA FNTTGVSSVQTPHLPTHADSQTPSAGTDTQTFSGS AANAKLNPTPGSNAISDVPGERSTASTFPTDPVSP LTTTLSLAHHSSAALPARTSNTTITANTSDAYLNA SETTTLSPSGSAVISTTTIATTPSKPTCDEKYANI TVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEV HNLTECKNASVSISHNSCTAPDKTLILDVPPGVEK FQLHDCTQVEKADTTICLKWKNIETFTCDTQNITY RFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNN HKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVI TWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYD LQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTT KSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPH ERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDY TFKAYFHNGDYPGEPFILHHSTSYNSK
Tag info
N-terminal 6xHis-SUMO-tagged
Expression Region
24-575aa
Protein length
Extracellular Domain
MW
76.8 kDa
Alternative Name(s)
Leukocyte common antigen
Relevance
Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity
Reference
"Structural variants of human T200 glycoprotein (leukocyte-common antigen)."
Ralph S.J., Thomas M.L., Morton C.C., Trowbridge I.S.
EMBO J. 6:1251-1257(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close