Comparison

Recombinant Human Receptor-type tyrosine-protein phosphatase C(PTPRC),Partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP019049HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Leukocyte common antigen
AA Sequence
QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPA STFERENDFSETTTSLSPDNTSTQVSPDSLDNASA FNTTGVSSVQTPHLPTHADSQTPSAGTDTQTFSGS AANAKLNPTPGSNAISDVPGERSTASTFPTDPVSP LTTTLSLAHHSSAALPARTSNTTITANTSDAYLNA SETTTLSPSGSAVISTTTIATTPSKPTCDEKYANI TVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEV HNLTECKNASVSISHNSCTAPDKTLILDVPPGVEK FQLHDCTQVEKADTTICLKWKNIETFTCDTQNITY RFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNN HKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVI TWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYD LQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTT KSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPH ERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDY TFKAYFHNGDYPGEPFILHHSTSYNSK
Research Topic
Immunology
Uniprot ID
P08575
Gene Names
PTPRC
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
24-575aa
MW of Fusion Proten
76, 8
Sequence Info
Extracellular Domain
Relevance
Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity
Reference
"Structural variants of human T200 glycoprotein (leukocyte-common antigen)."
Ralph S.J., Thomas M.L., Morton C.C., Trowbridge I.S.
EMBO J. 6:1251-1257(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close