Recombinant Human Ras-related protein Rab-10(RAB10),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP019152HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P61026
Gene Names
RAB10
Organism
Homo sapiens (Human)
AA Sequence
MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFN TTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLR NIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI AREHGIRFFETSAKANINIEKAFLTLAEDILRKTP VKEPNSENVDISSGGGVTGWK
Expression Region
1-196aa
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
MW
26.1 kDa
Relevance
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is mainly involved in the biosynthetic transport of proteins from the Golgi to the plasma membrane. Regulates, for instance, SLC2A4/GLUT4 glucose transporter-enriched vesicles delivery to the plasma membrane. In parallel, it regulates the transport of TLR4, a toll-like receptor to the plasma membrane and therefore may be important for innate immune response. Plays also a specific role in asymmetric protein transport to the plasma membrane within the polarized neuron and epithelial cells. In neurons, it is involved in axonogenesis through regulation of vesicular membrane trafficking toward the axonal plasma membrane while in epithelial cells, it regulates transport from the Golgi to the basolateral membrane. Moreover, may play a role in the basolateral recycling pathway and in phagosome maturation.may play a role in endoplasmic reticulum dynamics and morphology controlling tubulation along microtubules and tubules fusion.
Reference
"Rab10 regulates membrane transport through early endosomes of polarized Madin-Darby canine kidney cells."
Babbey C.M., Ahktar N., Wang E., Chen C.C., Grant B.D., Dunn K.W.
Mol. Biol. Cell 17:3156-3175(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close