Comparison

Recombinant Human Ras-related protein Rab-11A(RAB11A)

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against other
Format Liquid or Lyophilized powder
Amount 50ug
Host E.coli
Item no. CSB-EP019153HU-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research areas
Cancer
Target / Protein
RAB11A
Biologically active
Not Test
Expression system
E.coli
Species of origin
Homo sapiens (Human)
Uniprot ID
P62491
AA Sequence
GTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEF NLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQE RYRAITSAYYRGAVGALLVYDIAKHLTYENVERWL KELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA FAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIV SQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ CC
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-213aa
Protein length
Full Length of Mature Protein
MW
39.9 kDa
Alternative Name(s)
YL8
Relevance
The small GTPases Rab are key regulators of intracellular mbrane trafficking, from the formation of transport vesicles to their fusion with mbranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to mbranes different set of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. That Rab regulates endocytic recycling. Acts as a major regulator of mbrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical mbrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma mbrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma mbrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma mbrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral mbranes. May also play a role in melanosome transport and release from melanocytes.
References
Identification and characterization of a human homolog of the Schizosaccharomyces pombe ras-like gene YPT-3.Drivas G.T., Shih A., Coutavas E.E., D'Eustachio P., Rush M.G.Oncogene 6:3-9(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab regulates endocytic recycling. Acts as a major regulator of membrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma membrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma membrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral membranes. May also play a role in melanosome transport and release from melanocytes.
Subcellular Location
Cell membrane, Lipid-anchor, Recycling endosome membrane, Lipid-anchor, Cleavage furrow, Cytoplasmic vesicle, phagosome
Protein Families
Small GTPase superfamily, Rab family
Paythway
Endocytosis
Tag Information
N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close