Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP019153MO-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Neuroscience |
Uniprot ID |
Q9CYK2 |
Gene Names |
Qpct |
Organism |
Mus musculus (Mouse) |
AA Sequence |
AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQND LRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVV EVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLAC HYDSKYFPRWDSRVFVGATDSAVPCAMMLELARAL DKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSP QDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLL VLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELY ELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKG VPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNK IIQVFVLEYLHL |
Expression Region |
36-362aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
41.6 kDa |
Alternative Name(s) |
Glutaminyl cyclase Short name:QC; Glutaminyl-tRNA cyclotransferase |
Relevance |
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity). |
Reference |
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity). |
Subcellular Location |
Secreted |
Protein Families |
Glutaminyl-peptide cyclotransferase family |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.