« Back
Home /
Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)

Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	50ug
Host	E.coli
Item no.	CSB-EP019153MO-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Neuroscience
Uniprot ID	Q9CYK2
Gene Names	Qpct
Organism	Mus musculus (Mouse)
AA Sequence	AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQND LRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVV EVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLAC HYDSKYFPRWDSRVFVGATDSAVPCAMMLELARAL DKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSP QDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLL VLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELY ELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKG VPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNK IIQVFVLEYLHL
Expression Region	36-362aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	41.6 kDa
Alternative Name(s)	Glutaminyl cyclase Short name:QC; Glutaminyl-tRNA cyclotransferase
Relevance	Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity).
Reference	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity).
Subcellular Location	Secreted
Protein Families	Glutaminyl-peptide cyclotransferase family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP019153MO-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time