« Back
Home /
Recombinant Human Ras-related protein Rab-27B(RAB27B)

Recombinant Human Ras-related protein Rab-27B(RAB27B)

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Bladder Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP019178HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	O00194
Gene Names	RAB27B
Organism	Homo sapiens (Human)
AA Sequence	TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNP KFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQ LWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQS FLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQR EVNERQARELADKYGIPYFETSAATGQNVEKAVET LLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKP PEKKCIC
Expression Region	2-218aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	40.5 kDa
Alternative Name(s)	C25KG
Relevance	May be involved in targeting uroplakins to urothelial apical mbranes.
Reference	Molecular cloning and characterization of rab27a and rab27b, novel human rab proteins shared by melanocytes and platelets.Chen D., Guo J., Miki T., Tachibana M., Gahl W.A.Biochem. Mol. Med. 60:27-37(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in targeting uroplakins to urothelial apical membranes.
Subcellular Location	Membrane, Lipid-anchor
Protein Families	Small GTPase superfamily, Rab family
Tissue Specificity	Expressed primarily in testis.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP019178HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time