Comparison

Recombinant Human Ras-related protein Rab-2A(RAB2A)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP019180HU-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cancer
Uniprot ID
P61019
Gene Names
RAB2A
Organism
Homo sapiens (Human)
AA Sequence
AYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHD LTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSI TRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQ HSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREH GLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVF DINNEANGIKIGPQHAATNATHAGNQGGQQAGGGC
Expression Region
2-212aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
39.4 kDa
Relevance
Required for protein transport from the endoplasmic reticulum to the Golgi complex.
Reference
Nucleotide sequence of a new YPT1-related human cDNA which belongs to the ras gene superfamily.Tachibana K., Umezawa A., Kato S., Takano T.Nucleic Acids Res. 16:10368-10368(1988)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Required for protein transport from the endoplasmic reticulum to the Golgi complex.
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane, Lipid-anchor, Melanosome, Endoplasmic reticulum membrane, Lipid-anchor, Golgi apparatus membrane, Lipid-anchor
Protein Families
Small GTPase superfamily, Rab family
Paythway
AMPKSignaling
Amount: 1mg
Available: In stock
Listprice: €1,552.27
Price: €1,552.27
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close