Comparison

Recombinant Human Ras-related protein Rab-2A(RAB2A)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP019180HU-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
AYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHD LTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSI TRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQ HSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREH GLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVF DINNEANGIKIGPQHAATNATHAGNQGGQQAGGGC
Research Topic
Cancer
Uniprot ID
P61019
Gene Names
RAB2A
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-212aa
MW of Fusion Proten
39, 4
Sequence Info
Full Length
Relevance
Required for protein transport from the endoplasmic reticulum to the Golgi complex.
Reference
Nucleotide sequence of a new YPT1-related human cDNA which belongs to the ras gene superfamily.Tachibana K., Umezawa A., Kato S., Takano T.Nucleic Acids Res. 16:10368-10368(1988)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 500ug
Available: In stock
Listprice: €880.00
Price: €880.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close