Recombinant Human Ras-related protein Rab-5B(RAB5B)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP019214HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
P61020
Gene Names
RAB5B
Organism
Homo sapiens (Human)
AA Sequence
TSRSTARPNGQPQASKICQFKLVLLGESAVGKSSL VLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKF EIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQE TFARAKTWVKELQRQASPSIVIALAGNKADLANKR MVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLA IAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQ CCSN
Expression Region
1-215aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
50.6 kDa
Relevance
Protein transport. Probably involved in vesicular traffic .
Reference
"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close