« Back
Home /
Recombinant Human Ras-related protein Rab-5C(RAB5C)

Recombinant Human Ras-related protein Rab-5C(RAB5C)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP019215HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	P51148
Gene Names	RAB5C
Organism	Homo sapiens (Human)
AA Sequence	MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKS SLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITN TDTFARAKNWVKELQRQASPNIVIALAGNKADLAS KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIF MAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR SQCCSN
Expression Region	1-216aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	39.5 kDa
Alternative Name(s)	L1880RAB5L
Relevance	Protein transport. Probably involved in vesicular traffic .
Reference	Isolation and mapping of a human gene (RABL) encoding a small GTP-binding protein homologous to the Ras-related RAB gene.Han H.J., Sudo K., Inazawa J., Nakamura Y.Cytogenet. Cell Genet. 73:137-139(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Protein transport. Probably involved in vesicular traffic (By similarity).
Subcellular Location	Cell membrane, Lipid-anchor, Cytoplasmic side, Early endosome membrane, Lipid-anchor, Melanosome
Protein Families	Small GTPase superfamily, Rab family
Paythway	Rassignalingpathway
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time