Comparison

Recombinant Human Ras-related protein Rab-8A(RAB8A),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP019222HU(F1)-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Oncogene c-mel
AA Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTF ISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRT ITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIE EHASADVEKMILGNKCDVNDKRQVSKERGEKLALD YGIKFMETSAKANINVENAFFTLARDIKAKMDKKL EGNSPQGSNQGVKITP
Research Topic
Signal Transduction
Uniprot ID
P61006
Gene Names
RAB8A
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
3-193aa
MW of Fusion Proten
37, 8
Sequence Info
Partial
Relevance
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in polarized vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization. Plays an important role in ciliogenesis. Together with MICALL2, may also regulate adherens junction assembly. May play a role in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore play a role in glucose homeostasis.
Reference
"The MEL gene: a new member of the RAB/YPT class of RAS-related genes."Nimmo E.R., Sanders P.G., Padua R.A., Hughes D., Williamson R., Johnson K.J.Oncogene 6:1347-1351(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close