Comparison

Recombinant Human Ras-related C3 botulinum toxin substrate 3(RAC3)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP019249HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
p21-Rac3
AA Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPT VFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHC PHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYP QGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRA VLCPPPVKKPGKKC
Research Topic
Signal Transduction
Uniprot ID
P60763
Gene Names
RAC3
Tag Info
N-terminal GST-tagged
Expression Region
1-192aa
MW of Fusion Proten
48
Sequence Info
Full Length
Relevance
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.
Reference
"Characterization of RAC3, a novel member of the Rho family."
Haataja L., Groffen J., Heisterkamp N.
J. Biol. Chem. 272:20384-20388(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close