Recombinant Human Cell cycle checkpoint protein RAD1(RAD1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP019252HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O60671
Gene Names
RAD1
Organism
Homo sapiens (Human)
AA Sequence
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIH FREHATCFATKNGIKVTVENAKCVQANAFIQAGIF QEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTL TALRMCYQGYGYPLMLFLEEGGVVTVCKINTQEPE ETLDFDFCSTNVINKIILQSEGLREAFSELDMTSE VLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLM EAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRT DNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES ES
Expression Region
1-282aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
58.8 kDa
Alternative Name(s)
DNA repair exonuclease rad1 homolog
Rad1-like DNA damage checkpoint protein
Relevance
Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase. Isoform 1 possesses 3'->5' double stranded DNA exonuclease activity.
Reference
"Human and mouse homologs of Schizosaccharomyces pombe rad1(+) and Saccharomyces cerevisiae RAD17: linkage to checkpoint control and mammalian meiosis."
Freire R., Murguia J.R., Tarsounas M., Lowndes N.F., Moens P.B., Jackson S.P.
Genes Dev. 12:2560-2573(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close