Comparison

Recombinant Human DNA repair protein RAD51 homolog 4(RAD51D)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP019268HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
R51H3
RAD51 homolog D
RAD51-like protein 3
TRAD
AA Sequence
MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSAD LEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGAD LYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEI VGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGG LTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDI FQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTA VVSPLLGGQQREGLALMMQLARELKTLARDLGMAV VVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDT IEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWG TSEQSATLQGDQT
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O75771
Gene Names
RAD51L3
Tag Info
N-terminal GST-tagged
Expression Region
1-328aa
MW of Fusion Proten
62
Sequence Info
Full Length
Relevance
Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. Bind to single-stranded DNA (ssDNA) and has DNA-dependent ATPase activity. Part of the Rad21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. Involved in telomere maintenance. The BCDX2 subcomplex XRCC2:RAD51D can stimulate Holliday junction resolution by BLM.
Reference
"Multiple alternative transcripts of the human homologue of the mouse TRAD/R51H3/RAD51D gene, a member of the recA/RAD51 gene family."
Kawabata M., Saeki K.
Biochem. Biophys. Res. Commun. 257:156-162(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,992.57
Price: €1,992.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close