Comparison

Recombinant Human mRNA export factor(RAE1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP019276HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Rae1 protein homolog
mRNA-associated protein mrnp 41
AA Sequence
MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVT SSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWE VQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTAS CDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPN YSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYC ADVIYPMAVVATAERGLIVYQLENQPSEFRRIESP LKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYI NPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIA FHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLD QPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKK NYIFLRNAAEELKPRNKK
Research Topic
others
Uniprot ID
P78406
Gene Names
RAE1
Tag Info
N-terminal GST-tagged
Expression Region
1-368aa
MW of Fusion Proten
68
Sequence Info
Full Length
Relevance
Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.
Reference
"The human RAE1 gene is a functional homologue of Schizosaccharomyces pombe rae1 gene involved in nuclear export of poly(A)+ RNA."
Bharathi A., Ghosh A., Whalen W.A., Yoon J.H., Pu R., Dasso M., Dhar R.
Gene 198:251-258(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close