« Back
Home /
Recombinant Human RNA binding protein fox-1 homolog 2(RBFOX2)

Recombinant Human RNA binding protein fox-1 homolog 2(RBFOX2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Host	E.coli
Item no.	CSB-EP019439HU-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Transcription
Uniprot ID	O43251
Gene Names	RBFOX2
Organism	Homo sapiens (Human)
AA Sequence	MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQ NGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGE QSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSE SKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDV EIIFNERGSKGFGFVTFENSADADRAREKLHGTVV EGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVG AVYGPELYAASSFQADVSLGNDAAVPLSGRGGINT YIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGR TVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGY AAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD PYHALAPAASYGVGAVASLYRGGYSRFAPY
Expression Region	1-380aa
Sequence Info	Full Length of Isoform 10
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	44.4 kDa
Alternative Name(s)	Fox-1 homolog BHexaribonucleotide-binding protein 2RNA-binding motif protein 9RNA-binding protein 9Repressor of tamoxifen transcriptional activity
Relevance	RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elents. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis . RNA-binding protein that ses to act as a coregulatory factor of ER-alpha.1 Publication
Reference	XRbm9, a new XGld2-interacting protein, enhances translation in Xenopus oocytes.Papin C.Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis (By similarity). RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.
Subcellular Location	Nucleus, Cytoplasm
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time