Comparison

Recombinant Human Recoverin(RCVRN)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP019519HU-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
P35243
Gene Names
RCVRN
Organism
Homo sapiens (Human)
AA Sequence
GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFL KDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFR SFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAF SLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLL PDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGT LANKEILRLIQFEPQKVKEKMKNA
Expression Region
2-200aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
27 kDa
Alternative Name
Cancer-associated retinopathy protein . Protein CAR
Relevance
Ses to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
Reference
Expression of a photoreceptor protein, recoverin, as a cancer-associated retinopathy autoantigen in human lung cancer cell lines.Matsubara S., Yamaji Y., Sato M., Fujita J., Takahara J.Br. J. Cancer 74:1419-1422(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
Protein Families
Recoverin family
Tissue Specificity
Retina and pineal gland.
Amount: 1mg
Available: In stock
Listprice: €1,552.27
Price: €1,552.27
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close