Comparison

Recombinant human Retinol dehydrogenase 11(RDH11),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP019523HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
Q8TC12
Gene Names
RDH11
Organism
Homo sapiens (Human)
AA Sequence
PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKE TAKELAQRGARVYLACRDVEKGELVAKEIQTTTGN QQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLIN NAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLL EKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFY NAGLAYCHSKLANILFTQELARRLKGSGVTTYSVH PGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQT SLHCALTEGLEILSGNHFSDCHVAWVSAQARNETI ARRLWDVSCDLLGLPID
Expression Region
22-318aa
Sequence Info
Cytoplasmic Domain
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
49 kDa
Alternative Name
Androgen-regulated short-chain dehydrogenase/reductase 1HCV core-binding protein HCBP12. Prostate short-chain dehydrogenase/reductase 1Retinal reductase 1 . RalR1Short chain dehydrogenase/reductase family 7C member 1
Relevance
Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.
Reference
"Initial characterization of the human central proteome."Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.
Involvement in disease
Retinal dystrophy, juvenile cataracts, and short stature syndrome (RDJCSS)
Subcellular Location
Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity
Predominantly expressed in the epithelial cells of prostate, in both basal and luminal secretory cell populations. Expressed at low levels in spleen, thymus, testis, ovary, small intestine, colon, peripherical blood leukocytes, kidney, adrenal gland and fetal liver. Not detected in prostatic fibromuscular stromal cells, endothelial cells, or infiltrating lymphocytes.
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close