Comparison

Recombinant human Retinol dehydrogenase 11(RDH11),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP019523HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Androgen-regulated short-chain dehydrogenase/reductase 1HCV core-binding protein HCBP12; Prostate short-chain dehydrogenase/reductase 1Retinal reductase 1 ; RalR1Short chain dehydrogenase/reductase family 7C member 1
AA Sequence
PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKE TAKELAQRGARVYLACRDVEKGELVAKEIQTTTGN QQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLIN NAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLL EKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFY NAGLAYCHSKLANILFTQELARRLKGSGVTTYSVH PGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQT SLHCALTEGLEILSGNHFSDCHVAWVSAQARNETI ARRLWDVSCDLLGLPID
Research Topic
Neuroscience
Uniprot ID
Q8TC12
Gene Names
RDH11
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
22-318aa
MW of Fusion Proten
49
Sequence Info
Cytoplasmic Domain
Relevance
Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.
Reference
"Initial characterization of the human central proteome."Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close