Comparison

Recombinant Rat Regenerating islet-derived protein 3-alpha(Reg3a)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP019548RA-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P35231
Gene Names
Reg3a
Organism
Rattus norvegicus (Rat)
AA Sequence
EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSW FQADLACQKRPSGHLVSILSGGEASFVSSLVTGRV NNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYL NWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVE LPFVCKFKQ
Expression Region
26-174aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
20.5 kDa
Alternative Name
Islet of Langerhans regenerating protein 3 . REG 3Lithostathine 3. Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha . Reg III-alpha
Relevance
Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway .
Reference
Identification of a second rat pancreatitis-associated protein. Messenger RNA cloning, gene structure, and expression during acute pancreatitis.Frigerio J.-M., Dusetti N.J., Keim V., Dagorn J.-C., Iovanna J.L.Biochemistry 32:9236-9241(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway (By similarity).
Involvement in disease
Overexpressed during the acute phase of pancreatitis.
Subcellular Location
Secreted
Tissue Specificity
Low expression found in healthy pancreas.
Amount: 10ug
Available: In stock
Listprice: €230.66
Price: €230.66
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close