« Back
Home /
Recombinant Rat Regenerating islet-derived protein 3-gamma(Reg3g)

Recombinant Rat Regenerating islet-derived protein 3-gamma(Reg3g)

Manufacturer	Cusabio
Category	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Host	E.coli
Item no.	CSB-EP019549RA-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Others
Uniprot ID	P42854
Gene Names	Reg3g
Organism	Rattus norvegicus (Rat)
AA Sequence	EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSW FDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSG NSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYF NWETNPSSVSGSHCGTLTRASGFLRWRENNCISEL PYVCKFKA
Expression Region	27-174aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	20.3 kDa
Alternative Name(s)	Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ; Reg III-gamma
Relevance	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury .
Reference	Reg3G gene expression in regenerating skeletal muscle and corresponding nerve.Klasan G.S., Ivanac D., Erzen D.J., Picard A., Takasawa S., Peharec S., Arbanas J., Girotto D., Jerkovic R.Muscle Nerve 49:61-68(2014)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury (By similarity).
Subcellular Location	Secreted, Cytoplasm
Tissue Specificity	Expressed in injured skeletal muscles and sciatic nerve (at protein level). Expressed in the pancreas. Expression increases during the acute phase of pancreatitis.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time