Comparison

Recombinant Rat Regenerating islet-derived protein 3-gamma(Reg3g)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP019549RA-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ; Reg III-gamma
AA Sequence
EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSW FDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSG NSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYF NWETNPSSVSGSHCGTLTRASGFLRWRENNCISEL PYVCKFKA
Research Topic
Others
Uniprot ID
P42854
Gene Names
Reg3g
Tag Info
N-terminal 6xHis-tagged
Expression Region
27-174aa
MW of Fusion Proten
20, 3
Sequence Info
Full Length
Relevance
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury .
Reference
Reg3G gene expression in regenerating skeletal muscle and corresponding nerve.Klasan G.S., Ivanac D., Erzen D.J., Picard A., Takasawa S., Peharec S., Arbanas J., Girotto D., Jerkovic R.Muscle Nerve 49:61-68(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Rattus norvegicus (Rat)
Amount: 100ug
Available: In stock
Listprice: €495.78
Price: €495.78
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close