Comparison

Recombinant Human Reelin(RELN),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP019557HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
AAGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLH IAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTS TSVQASQSIGGSSAFGFGIMSDHQFGNQFMCSVVA SHVSHLPTTNLSFIWIAPPAGTGCVNFMATATHRG QVIFKDALAQQLCEQGAPTDVTVHPHLAEIHSDSI ILRDDFDSYHQLQLNPNIWVECNNCETGEQCGAIM HGNAVTFCEPYGPRELITT
Research Topic
Cell Adhesion
Uniprot ID
P78509
Gene Names
RELN
Tag Info
N-terminal 6xHis-tagged
Expression Region
26-254aa
MW of Fusion Proten
28, 9
Sequence Info
Partial
Relevance
Extracellular domain matrix serine protease that plays a role in layering of neurons in the cerebral cortex and cerebellum. Regulates microtubule function in neurons and neuronal migration. Affects migration of sympathetic preganglionic neurons in the spinal cord, where it ses to act as a barrier to neuronal migration. Enzymatic activity is important for the modulation of cell adhesion. Binding to the Extracellular domains of lipoprotein receptors VLDLR and LRP8/APOER2 induces tyrosine phosphorylation of DAB1 and modulation of TAU phosphorylation .
Reference
Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close