Comparison

Recombinant Human Regulator of G-protein signaling 10(RGS10)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP019642HU-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKST AKWAASLENLLEDPEGVKRFREFLKKEFSEENVLF WLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQ VNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKY DSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRA SRIYNT
Research Topic
Signal Transduction
Uniprot ID
O43665
Gene Names
RGS10
Tag Info
N-terminal GST-tagged
Expression Region
1-181aa
MW of Fusion Proten
48, 2
Sequence Info
Full Length of Isoform 3
Relevance
Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Modulates the activity of potassium channels that are activated in response to CHRM2 signaling. Activity on GNAZ is inhibited by palmitoylation of the G-protein
Reference
"RGS10 is a selective activator of G alpha i GTPase activity."
Hunt T.W., Fields T.A., Casey P.J., Peralta E.G.
Nature 383:175-177(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close