Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP019651HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research areas |
Signal Transduction |
Target / Protein |
RGS2 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P41220 |
AA Sequence |
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKR TLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEF CEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQK RVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
1-211aa |
Protein length |
Full Length |
MW |
40.4 kDa |
Alternative Name(s) |
Cell growth-inhibiting gene 31 protein; G0/G1 switch regulatory protein 8 |
Relevance |
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving th into their inactive GDP-bound form. May play a role in leukogenesis. Plays a role in negative feedback control pathway for adenylyl cyclase signaling. Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein. |
References |
A human gene encoding a putative basic helix-loop-helix phosphoprotein whose mRNA increases rapidly in cycloheximide-treated blood mononuclear cells.Siderovski D.P., Heximer S.P., Forsdyke D.R.DNA Cell Biol. 13:125-147(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form |
Subcellular Location |
Isoform 1: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 4: Cell membrane, Mitochondrion |
Tissue Specificity |
Expressed in acute myelogenous leukemia (AML) and in acute lymphoblastic leukemia (ALL). |
Paythway |
cGMP-PKGsignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.