Comparison

Recombinant Human Regulator of G-protein signaling 2(RGS2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 10ug
Host E.coli
Item no. CSB-EP019651HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P41220
Gene Names
RGS2
Organism
Homo sapiens (Human)
AA Sequence
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKR TLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEF CEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQK RVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA
Expression Region
1-211aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
40.4 kDa
Alternative Name
Cell growth-inhibiting gene 31 protein. G0/G1 switch regulatory protein 8
Relevance
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving th into their inactive GDP-bound form. May play a role in leukogenesis. Plays a role in negative feedback control pathway for adenylyl cyclase signaling. Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein.
Reference
A human gene encoding a putative basic helix-loop-helix phosphoprotein whose mRNA increases rapidly in cycloheximide-treated blood mononuclear cells.Siderovski D.P., Heximer S.P., Forsdyke D.R.DNA Cell Biol. 13:125-147(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form
Subcellular Location
Isoform 1: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 4: Cell membrane, Mitochondrion
Tissue Specificity
Expressed in acute myelogenous leukemia (AML) and in acute lymphoblastic leukemia (ALL).
Paythway
cGMP-PKGsignalingpathway
Amount: 10ug
Available: In stock
Listprice: €175.45
Price: €175.45
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close