Recombinant Human Regulator of G-protein signaling 5(RGS5)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP019657HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
O15539
Gene Names
RGS5
Organism
Homo sapiens (Human)
AA Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGD LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQ NNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKS PAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITM KNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEF YQELIK
Expression Region
1-181aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
47.9 kDa
Relevance
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha
Reference
"Genetic screens in yeast to identify mammalian nonreceptor modulators of G-protein signaling."
Cismowski M.J., Takesono A., Ma C., Lizano J.S., Xie X., Fuernkranz H., Lanier S.M., Duzic E.
Nat. Biotechnol. 17:878-883(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close