« Back
Home /
Recombinant Human Regulator of G-protein signaling 5(RGS5)

Recombinant Human Regulator of G-protein signaling 5(RGS5)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	E.coli
Item no.	CSB-EP019657HU-500
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	O15539
Gene Names	RGS5
Organism	Homo sapiens (Human)
AA Sequence	MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGD LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQ NNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKS PAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITM KNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEF YQELIK
Expression Region	1-181aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	47.9 kDa
Relevance	Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha
Reference	"Genetic screens in yeast to identify mammalian nonreceptor modulators of G-protein signaling." Cismowski M.J., Takesono A., Ma C., Lizano J.S., Xie X., Fuernkranz H., Lanier S.M., Duzic E. Nat. Biotechnol. 17:878-883(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha (By similarity).
Subcellular Location	Isoform 1: Cytoplasm, Membrane, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time