Comparison

Recombinant Human Regulator of G-protein signaling 7(RGS7)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP019659HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQ DEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNL TIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDG TFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNK ARLELADYEAESLARLQRAFARKWEFIFMQAEAQA KVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTT EVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHT PTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVA DSLLSYTEQYLEYDPFLLPPDPSNPWLSDDTTFWE LEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKF LESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIW QEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSG NSMDRRTSFEKFAQNVGKSLTSKRLTSLAQSY
Research Topic
Signal Transduction
Uniprot ID
P49802
Gene Names
RGS7
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-487aa
MW of Fusion Proten
60, 7
Sequence Info
Full Length of Isoform 5
Relevance
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving th into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/GNG5 dimer. May play a role in synaptic vesicle exocytosis. May play important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations .
Reference
cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org).Puhl H.L. III, Ikeda S.R., Aronstam R.S. The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close