« Back
Home /
Recombinant Human Rhomboid-related protein 2(RHBDL2),partial

Recombinant Human Rhomboid-related protein 2(RHBDL2),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP019672HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Others
Target / Protein	RHBDL2
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	Q9NX52
AA Sequence	MNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVH RIVSKWMLPEKSRGTYLERANCFPPPVFIISISLA ELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEK REEAWRFISYMLVHAG
Tag Info	N-terminal 6xHis-tagged
Expression Region	12-132aa
Protein length	Partial
MW	18.2 kDa
Alternative Name(s)	Rhomboid-like protein 2
Relevance	Involved in regulated intrambrane proteolysis and the subsequent release of functional polypeptides from their mbrane anchors. Known substrate: EFNB3.
References	The processing of human rhomboid intramembrane serine protease RHBDL2 is required for its proteolytic activity.Lei X., Li Y.M.J. Mol. Biol. 394:815-825(2009)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. Known substrate
Subcellular Location	Rhomboid-related protein 2, C-terminal fragment: Cell membrane, Multi-pass membrane protein
Protein Families	Peptidase S54 family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP019672HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time