Comparison

Recombinant Human Rhomboid-related protein 2(RHBDL2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP019672HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Rhomboid-like protein 2
AA Sequence
MNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVH RIVSKWMLPEKSRGTYLERANCFPPPVFIISISLA ELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEK REEAWRFISYMLVHAG
Research Topic
Others
Uniprot ID
Q9NX52
Gene Names
RHBDL2
Tag Info
N-terminal 6xHis-tagged
Expression Region
12-132aa
MW of Fusion Proten
18, 2
Sequence Info
Partial
Relevance
Involved in regulated intrambrane proteolysis and the subsequent release of functional polypeptides from their mbrane anchors. Known substrate: EFNB3.
Reference
The processing of human rhomboid intramembrane serine protease RHBDL2 is required for its proteolytic activity.Lei X., Li Y.M.J. Mol. Biol. 394:815-825(2009)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close