Comparison

Recombinant Human Rho guanine nucleotide exchange factor 18(ARHGEF18),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP019681HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P08100
Gene Names
RHO
Organism
Homo sapiens (Human)
AA Sequence
MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPW
Expression Region
1-36aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
20.2 kDa
Alternative Name
Opsin-2
Relevance
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal.
Reference
"Isolation and nucleotide sequence of the gene encoding human rhodopsin."Nathans J., Hogness D.S.Proc. Natl. Acad. Sci. U.S.A. 81:4851-4855(1984)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Photoreceptor required for image-forming vision at low light intensity
Involvement in disease
Retinitis pigmentosa 4 (RP4); Night blindness, congenital stationary, autosomal dominant 1 (CSNBAD1)
Subcellular Location
Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity
Rod shaped photoreceptor cells which mediate vision in dim light.
Amount: 100ug
Available: In stock
Listprice: €560.05
Price: €560.05
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close