« Back
Home /
Recombinant Human Rhodopsin(RHO),partial

Recombinant Human Rhodopsin(RHO),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP019681HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	P08100
Gene Names	RHO
Organism	Homo sapiens (Human)
AA Sequence	MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPW
Expression Region	1-36aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	20.2 kDa
Alternative Name(s)	Opsin-2
Relevance	Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal.
Reference	"Isolation and nucleotide sequence of the gene encoding human rhodopsin."Nathans J., Hogness D.S.Proc. Natl. Acad. Sci. U.S.A. 81:4851-4855(1984)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Photoreceptor required for image-forming vision at low light intensity
Involvement in disease	Retinitis pigmentosa 4 (RP4); Night blindness, congenital stationary, autosomal dominant 1 (CSNBAD1)
Subcellular Location	Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families	G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity	Rod shaped photoreceptor cells which mediate vision in dim light.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP019681HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time