Comparison

Recombinant Human Receptor-interacting serine/threonine-protein kinase 2(RIPK2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP019736HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
CARD-containing interleukin-1 beta-converting enzyme-associated kinase ; CARD-containing IL-1 beta ICE-kinaseRIP-like-interacting CLARP kinaseReceptor-interacting protein 2 ; RIP-2Tyrosine-protein kinase RIPK2 (EC:2.7.10.2)
AA Sequence
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSA RHADWRVQVAVKHLHIHTPLLDSERKDVLREAEIL HKARFSYILPILGICNEPEFLGIVTEYMPNGSLNE LLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTP PLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSL SQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKH DIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQG HRPVINEESLPYDIPHRARMISLIESGWAQNPDER PSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQ SVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQ LHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKL HHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEAC LNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQL LDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILV VSRSPSLNLLQNKSM
Research Topic
Immunology
Uniprot ID
O43353
Gene Names
RIPK2
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-540aa
MW of Fusion Proten
65, 2
Sequence Info
Full Length
Relevance
Serine/threonine/tyrosine kinase that plays an essential role in modulation of innate and adaptive immune responses. Upon stimulation by bacterial peptidoglycans, NOD1 and NOD2 are activated, oligomerize and recruit RIPK2 through CARD-CARD domains. Contributes to the tyrosine phosphorylation of the guanine exchange factor ARHGEF2 through Src tyrosine kinase leading to NF-kappaB activation by NOD2. Once recruited, RIPK2 autophosphorylates and undergoes 'Lys-63'-linked polyubiquitination by E3 ubiquitin ligases XIAP, BIRC2 and BIRC3. The polyubiquitinated protein mediates the recruitment of MAP3K7/TAK1 to IKBKG/NO and induces 'Lys-63'-linked polyubiquitination of IKBKG/NO and subsequent activation of IKBKB/IKKB. In turn, NF-kappa-B is released from NF-kappa-B inhibitors and translocates into the nucleus where it activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Plays also a role during engagent of the T-cell receptor (TCR) in promoting BCL10 phosphorylation and subsequent NF-kappa-B activation.
Reference
Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.Mol. Cell 31:438-448(2008)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close