Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP019736HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Immunology |
Uniprot ID |
O43353 |
Gene Names |
RIPK2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSA RHADWRVQVAVKHLHIHTPLLDSERKDVLREAEIL HKARFSYILPILGICNEPEFLGIVTEYMPNGSLNE LLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTP PLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSL SQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKH DIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQG HRPVINEESLPYDIPHRARMISLIESGWAQNPDER PSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQ SVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQ LHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKL HHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEAC LNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQL LDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILV VSRSPSLNLLQNKSM |
Expression Region |
1-540aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
65.2 kDa |
Alternative Name(s) |
CARD-containing interleukin-1 beta-converting enzyme-associated kinase ; CARD-containing IL-1 beta ICE-kinaseRIP-like-interacting CLARP kinaseReceptor-interacting protein 2 ; RIP-2Tyrosine-protein kinase RIPK2 (EC:2.7.10.2) |
Relevance |
Serine/threonine/tyrosine kinase that plays an essential role in modulation of innate and adaptive immune responses. Upon stimulation by bacterial peptidoglycans, NOD1 and NOD2 are activated, oligomerize and recruit RIPK2 through CARD-CARD domains. Contributes to the tyrosine phosphorylation of the guanine exchange factor ARHGEF2 through Src tyrosine kinase leading to NF-kappaB activation by NOD2. Once recruited, RIPK2 autophosphorylates and undergoes 'Lys-63'-linked polyubiquitination by E3 ubiquitin ligases XIAP, BIRC2 and BIRC3. The polyubiquitinated protein mediates the recruitment of MAP3K7/TAK1 to IKBKG/NO and induces 'Lys-63'-linked polyubiquitination of IKBKG/NO and subsequent activation of IKBKB/IKKB. In turn, NF-kappa-B is released from NF-kappa-B inhibitors and translocates into the nucleus where it activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Plays also a role during engagent of the T-cell receptor (TCR) in promoting BCL10 phosphorylation and subsequent NF-kappa-B activation. |
Reference |
Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.Mol. Cell 31:438-448(2008) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Serine/threonine/tyrosine kinase that plays an essential role in modulation of innate and adaptive immune responses. Upon stimulation by bacterial peptidoglycans, NOD1 and NOD2 are activated, oligomerize and recruit RIPK2 through CARD-CARD domains. Contributes to the tyrosine phosphorylation of the guanine exchange factor ARHGEF2 through Src tyrosine kinase leading to NF-kappaB activation by NOD2. Once recruited, RIPK2 autophosphorylates and undergoes 'Lys-63'-linked polyubiquitination by E3 ubiquitin ligases XIAP, BIRC2 and BIRC3. The polyubiquitinated protein mediates the recruitment of MAP3K7/TAK1 to IKBKG/NEMO and induces 'Lys-63'-linked polyubiquitination of IKBKG/NEMO and subsequent activation of IKBKB/IKKB. In turn, NF-kappa-B is released from NF-kappa-B inhibitors and translocates into the nucleus where it activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Plays also a role during engagement of the T-cell receptor (TCR) in promoting BCL10 phosphorylation and subsequent NF-kappa-B activation. |
Subcellular Location |
Cytoplasm |
Protein Families |
Protein kinase superfamily, TKL Ser/Thr protein kinase family |
Tissue Specificity |
Detected in heart, brain, placenta, lung, peripheral blood leukocytes, spleen, kidney, testis, prostate, pancreas and lymph node. |
Paythway |
NOD-likereceptorsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.