Comparison

Recombinant Human Non-secretory ribonuclease(RNASE2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP019794HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2 ; RNase 2Ribonuclease US
AA Sequence
KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQR RCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKN CHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANM FYIVACDNRDQRRDPPQYPVVPVHLDRII
Research Topic
Immunology
Uniprot ID
P10153
Gene Names
RNASE2
Tag Info
N-terminal 6xHis-tagged
Expression Region
28-161aa
MW of Fusion Proten
19, 5
Sequence Info
Full Length
Relevance
This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chotactic for dendritic cells. Possesses a wide variety of biological activities.
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close