« Back
Home /
Recombinant Human Non-secretory ribonuclease(RNASE2)

Recombinant Human Non-secretory ribonuclease(RNASE2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Host	E.coli
Item no.	CSB-EP019794HU-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Immunology
Uniprot ID	P10153
Gene Names	RNASE2
Organism	Homo sapiens (Human)
AA Sequence	KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQR RCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKN CHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANM FYIVACDNRDQRRDPPQYPVVPVHLDRII
Expression Region	28-161aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	19.5 kDa
Alternative Name(s)	Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2 ; RNase 2Ribonuclease US
Relevance	This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chotactic for dendritic cells. Possesses a wide variety of biological activities.
Reference	An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.
Subcellular Location	Lysosome, Cytoplasmic granule
Protein Families	Pancreatic ribonuclease family
Tissue Specificity	Liver, lung, spleen, leukocytes and body fluids.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP019794HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time