Comparison

Recombinant Human Non-secretory ribonuclease(RNASE2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP019794HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
P10153
Gene Names
RNASE2
Organism
Homo sapiens (Human)
AA Sequence
KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQR RCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKN CHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANM FYIVACDNRDQRRDPPQYPVVPVHLDRII
Expression Region
28-161aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
19.5 kDa
Alternative Name
Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2 . RNase 2Ribonuclease US
Relevance
This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chotactic for dendritic cells. Possesses a wide variety of biological activities.
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.
Subcellular Location
Lysosome, Cytoplasmic granule
Protein Families
Pancreatic ribonuclease family
Tissue Specificity
Liver, lung, spleen, leukocytes and body fluids.
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close