Recombinant Human RING finger protein 212(RNF212)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP019872HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q495C1
Gene Names
RNF212
Organism
Homo sapiens (Human)
AA Sequence
MANWVFCNRCFQPPHRTSCFSLTNCGHVYCDACLG KGKKNECLICKAPCRTVLLSKHTDADIQAFFMSID SLCKKYSRETSQILEFQEKHRKRLLAFYREKISRL EESLRKSVLQIEQLQSMRSSQQTAFSTIKSSVSTK PHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAA GPARISMISPPQDGRMGPHLTASFCFIPWLTLSKP PVPGECVISRGSPCFCIDVCPHWLLLLAFSSGRHG ELTNSKTLPIYAEVQRAVLFPFQQAEGTLDTFRTP AVSVVFPLCQFERKKSF
Expression Region
1-297aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
60.4 kDa
Alternative Name(s)
RING finger protein 212
Relevance
SUMO E3 ligase that acts as a regulator of crossing-over during meiosis: required to couple chromosome synapsis to the formation of crossover-specific recombination complexes. Localizes to recombination sites and stabilizes meiosis-specific recombination factors, such as MutS-gamma complex proteins (MSH4 and MSH5) and TEX11. May mediate sumoylation of target proteins MSH4 and/or MSH5, leading to enhance their binding to recombination sites. Acts as a limiting factor for crossover designation and/or reinforcement and plays an antagonist role with CCNB1IP1/HEI10 in the regulation of meiotic recombination
Reference
"Targeted gene knockout reveals a role in meiotic recombination for ZHP-3, a Zip3-related protein in Caenorhabditis elegans."
Jantsch V., Pasierbek P., Mueller M.M., Schweizer D., Jantsch M., Loidl J.
Mol. Cell. Biol. 24:7998-8006(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close