Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
100ug |
Host |
E.coli |
Item no. |
CSB-EP019872HU-100 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Areas |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q495C1 |
Gene Names |
RNF212 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MANWVFCNRCFQPPHRTSCFSLTNCGHVYCDACLG KGKKNECLICKAPCRTVLLSKHTDADIQAFFMSID SLCKKYSRETSQILEFQEKHRKRLLAFYREKISRL EESLRKSVLQIEQLQSMRSSQQTAFSTIKSSVSTK PHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAA GPARISMISPPQDGRMGPHLTASFCFIPWLTLSKP PVPGECVISRGSPCFCIDVCPHWLLLLAFSSGRHG ELTNSKTLPIYAEVQRAVLFPFQQAEGTLDTFRTP AVSVVFPLCQFERKKSF |
Expression Region |
1-297aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
60.4 kDa |
Alternative Name(s) |
RING finger protein 212 |
Relevance |
SUMO E3 ligase that acts as a regulator of crossing-over during meiosis: required to couple chromosome synapsis to the formation of crossover-specific recombination complexes. Localizes to recombination sites and stabilizes meiosis-specific recombination factors, such as MutS-gamma complex proteins (MSH4 and MSH5) and TEX11. May mediate sumoylation of target proteins MSH4 and/or MSH5, leading to enhance their binding to recombination sites. Acts as a limiting factor for crossover designation and/or reinforcement and plays an antagonist role with CCNB1IP1/HEI10 in the regulation of meiotic recombination |
Reference |
Targeted gene knockout reveals a role in meiotic recombination for ZHP-3, a Zip3-related protein in Caenorhabditis elegans. Jantsch V., Pasierbek P., Mueller M.M., Schweizer D., Jantsch M., Loidl J. Mol. Cell. Biol. 24:7998-8006(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
SUMO E3 ligase that acts as a regulator of crossing-over during meiosis |
Subcellular Location |
Nucleus, Chromosome |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.