« Back
Home /
Recombinant Human RING finger protein 212(RNF212)

Recombinant Human RING finger protein 212(RNF212)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-EP019872HU-200
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	Q495C1
Gene Names	RNF212
Organism	Homo sapiens (Human)
AA Sequence	MANWVFCNRCFQPPHRTSCFSLTNCGHVYCDACLG KGKKNECLICKAPCRTVLLSKHTDADIQAFFMSID SLCKKYSRETSQILEFQEKHRKRLLAFYREKISRL EESLRKSVLQIEQLQSMRSSQQTAFSTIKSSVSTK PHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAA GPARISMISPPQDGRMGPHLTASFCFIPWLTLSKP PVPGECVISRGSPCFCIDVCPHWLLLLAFSSGRHG ELTNSKTLPIYAEVQRAVLFPFQQAEGTLDTFRTP AVSVVFPLCQFERKKSF
Expression Region	1-297aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	60.4 kDa
Alternative Name(s)	RING finger protein 212
Relevance	SUMO E3 ligase that acts as a regulator of crossing-over during meiosis: required to couple chromosome synapsis to the formation of crossover-specific recombination complexes. Localizes to recombination sites and stabilizes meiosis-specific recombination factors, such as MutS-gamma complex proteins (MSH4 and MSH5) and TEX11. May mediate sumoylation of target proteins MSH4 and/or MSH5, leading to enhance their binding to recombination sites. Acts as a limiting factor for crossover designation and/or reinforcement and plays an antagonist role with CCNB1IP1/HEI10 in the regulation of meiotic recombination
Reference	"Targeted gene knockout reveals a role in meiotic recombination for ZHP-3, a Zip3-related protein in Caenorhabditis elegans." Jantsch V., Pasierbek P., Mueller M.M., Schweizer D., Jantsch M., Loidl J. Mol. Cell. Biol. 24:7998-8006(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	SUMO E3 ligase that acts as a regulator of crossing-over during meiosis
Subcellular Location	Nucleus, Chromosome
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time