Comparison

Recombinant Human RING-box protein 2(RNF7)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP019897HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
CKII beta-binding protein 1 ; CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene protein
AA Sequence
ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWN AVAMWSWDVECDTCAICRVQVMDACLRCQAENKQE DCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDW VVQRIGK
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q9UBF6
Gene Names
RNF7
Tag Info
N-terminal GST-tagged
Expression Region
2-113aa
MW of Fusion Proten
39, 6
Sequence Info
Full Length
Relevance
Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, ses to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.
Reference
Protein kinase CKII interacts with and phosphorylates the SAG protein containing ring-H2 finger motif.Son M.-Y., Park J.-W., Kim Y.-S., Kang S.-W., Marshak D.R., Park W., Bae Y.-S.Biochem. Biophys. Res. Commun. 263:743-748(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close